|
|
Example for output from ProDomSequence: 1ppt (PDB)ProDom output appended by default
OUTPUTNote: comments marked by "## COMMENT: "
Quick guide through outputNOTE: all other PredictProtein output deleted from this file!
The following information has been received by the server: ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ________________________________________________________________________________ return concise phdacc test seq from phd people run prodom # 1ppt.pir ( 1ppt.hssp from: 1 to: 36 ) MPPRWASLLL LACSLLLLAV PPGTAGPSQP TYPGDDAPVE DLIRFYNDLQ QYLNVVTRHR YGRRSSSRVL CEEPMGAAGC ________________________________________________________________________________ --- ------------------------------------------------------------ --- Results from running BLAST against PRODOM domains --- --- PLEASE quote: --- F Corpet, J Gouzy, D Kahn (1998). The ProDom database --- of protein domain families. Nucleic Ac Res 26:323-326. --- --- BEGIN of BLASTP output BLASTP 1.4.7 [16-Oct-94] [Build 12:52:03 Oct 30 1994] Reference: Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990). Basic local alignment search tool. J. Mol. Biol. 215:403-10. Query= prot , (#) ppOld, 1ppt.pir ( 1ppt.hssp from: 1 to: 36 ) t1 (80 letters) Database: prodom_99_2 157,167 sequences; 18,560,502 total letters. Searching..................................................done Smallest Sum High Probability Sequences producing High-scoring Segment Pairs: Score P(N) N PD001267 p99.2 (53) PAHO(22) PYY(13) NEUY(12) // AMIDAT... 112 2.6e-11 1 PD041507 p99.2 (2) F13A(1) O08619(1) // FACTOR COAGULAT... 46 0.0013 2 PD123104 p99.2 (1) O00634_HUMAN // NETRIN2 LIKE PROTEIN 59 0.025 1 >PD001267 p99.2 (53) PAHO(22) PYY(13) NEUY(12) // AMIDATION HORMONE PANCREAS PANCREATIC POLYPEPTIDE PP NEUROPEPTIDE PRECURSOR SIGNAL CLEAVAGE Length = 36 Score = 112 (52.3 bits), Expect = 2.6e-11, P = 2.6e-11 Identities = 18/35 (51%), Positives = 27/35 (77%) Query: 27 PSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY 61 P +P YPGDDA E+L ++Y +L+ Y+N++TR RY Sbjct: 2 PPEPEYPGDDATPEELAQYYAELRHYINLITRPRY 36 >PD041507 p99.2 (2) F13A(1) O08619(1) // FACTOR COAGULATION XIII A CHAIN PRECURSOR PROTEIN GLUTAMINE GAMMAGLUTAMYLTRANSFERASE TRANSGLUTAMINASE Length = 62 Score = 46 (21.5 bits), Expect = 0.0013, Sum P(2) = 0.0013 Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 23 GTAGPSQPTYPGDDAPVEDL 42 G P+ GDD P EDL Sbjct: 12 GAIPPNNSNAAGDDLPTEDL 31 Score = 40 (18.7 bits), Expect = 0.0013, Sum P(2) = 0.0013 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 48 DLQQYLNVVTRHRYGRR 64 +LQ YLNV H + R Sbjct: 40 NLQDYLNVTAVHLFKER 56 >PD123104 p99.2 (1) O00634_HUMAN // NETRIN2 LIKE PROTEIN Length = 39 Score = 59 (27.5 bits), Expect = 0.025, P = 0.025 Identities = 13/36 (36%), Positives = 16/36 (44%) Query: 3 PRWASLLLLACSLLLLAVPPGTAGPSQPTYPGDDAP 38 P W LLL L A+ PG P+ P + AP Sbjct: 2 PGWPWGLLLTAGTLFAALSPGPPAPADPCHDEGGAP 37 Parameters: E=0.1 B=500 V=500 -ctxfactor=1.00 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H +0 0 BLOSUM62 0.324 0.140 0.445 same same same Query Frame MatID Length Eff.Length E S W T X E2 S2 +0 0 80 80 0.10 66 3 11 22 0.19 29 Statistics: Query Expected Observed HSPs HSPs Frame MatID High Score High Score Reportable Reported +0 0 56 (26.1 bits) 112 (52.3 bits) 4 4 Query Neighborhd Word Excluded Failed Successful Overlaps Frame MatID Words Hits Hits Extensions Extensions Excluded +0 0 2192 3580518 944662 2615876 19978 198 Database: prodom_99_2 Release date: unknown Posted date: 10:12 PM EDT Jul 29, 1999 # of letters in database: 18,560,502 # of sequences in database: 157,167 # of database sequences satisfying E: 3 No. of states in DFA: 516 (51 KB) Total size of DFA: 76 KB (128 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Real: 00:00:00 Time to search database: 5.13u 0.05s 5.18t Real: 00:00:05 Total cpu time: 5.15u 0.07s 5.22t Real: 00:00:05 --- END of BLASTP output --- ------------------------------------------------------------ --- --- Again: these results were obtained based on the domain data- --- base collected by Daniel Kahn and his coworkers in Toulouse. --- --- PLEASE quote: --- F Corpet, J Gouzy, D Kahn (1998). The ProDom database --- of protein domain families. Nucleic Ac Res 26:323-326. --- ________________________________________________________________________________Prodom links: --- ------------------------------------------------------------ --- --- Again: these results were obtained based on the domain data- --- base collected by Daniel Kahn and his coworkers in Toulouse. --- --- PLEASE quote: --- F Corpet, J Gouzy, D Kahn (1998). The ProDom database --- of protein domain families. Nucleic Ac Res 26:323-326. --- --- The general WWW page is on: ---- --------------------------------------- --- http://www.toulouse.inra.fr/prodom.html ---- --------------------------------------- --- --- For WWW graphic interfaces to PRODOM, in particular for your --- protein family, follow the following links (each line is ONE --- single link for your protein!!): --- http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom1=PD001267 ==> multiple alignment, consensus, PDB and PROSITE links of domain PD001267 http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom2=PD001267 ==> graphical output of all proteins having domain PD001267 http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom1=PD041507 ==> multiple alignment, consensus, PDB and PROSITE links of domain PD041507 http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom2=PD041507 ==> graphical output of all proteins having domain PD041507 http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom1=PD123104 ==> multiple alignment, consensus, PDB and PROSITE links of domain PD123104 http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom2=PD123104 ==> graphical output of all proteins having domain PD123104 --- --- NOTE: if you want to use the link, make sure the entire line --- is pasted as URL into your browser! --- --- END of PRODOM --- ------------------------------------------------------------ |
Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information