pp-logo


sign in   

PredictProtein - [Output Example]
Example for PHD output

Example for PHD output

Structure: 1hhp (PDB)

HIV-1 PROTEASE (BRU ISOLATE)


OUTPUT




Publication to reference in reporting results:
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

Rost, Burkhard; Sander, Chris: Prediction of protein structure
at better than 70% accuracy. J. Mol. Biol., 1993, 232, 584-599.
Rost, Burkhard; Sander, Chris: Combining evolutionary information
and neural networks to predict protein secondary structure.
Proteins, 1994, 19 (No. 1), in press.



Some statistics:
~~~~~~~~~~~~~~~~

Percentage of amino acids:

+--------------+--------+--------+--------+--------+--------+
| AA:          |    I   |    G   |    L   |    T   |    V   |
| % of AA:     |   13.1 |   13.1 |   12.1 |    8.1 |    6.1 |
+--------------+--------+--------+--------+--------+--------+
| AA:          |    Q   |    P   |    K   |    R   |    E   |
| % of AA:     |    6.1 |    6.1 |    6.1 |    4.0 |    4.0 |
+--------------+--------+--------+--------+--------+--------+
| AA:          |    D   |    N   |    A   |    W   |    M   |
| % of AA:     |    4.0 |    3.0 |    3.0 |    2.0 |    2.0 |
+--------------+--------+--------+--------+--------+--------+
| AA:          |    F   |    C   |    Y   |    S   |    H   |
| % of AA:     |    2.0 |    2.0 |    1.0 |    1.0 |    1.0 |
+--------------+--------+--------+--------+--------+--------+

Percentage of secondary structure predicted/observed:

+--------------+--------+--------+--------+
| SecStr:      |    H   |    E   |    L   |
| % Predicted: |    6.1 |   53.5 |   40.4 |
+--------------+--------+--------+--------+
| SecStr:      |    H   |    E   |    L   |
| % Observed:  |    7.1 |   48.5 |   44.4 |
+--------------+--------+--------+--------+

According to the following classes:
all-alpha:   %H>45 and %E< 5; all-beta : %H<5 and %E>45
alpha-beta : %H>30 and %E>20; mixed:    rest,
this means that the predicted class is:           mixed class
The class of the observed structure is:           mixed class







PHD output for your protein:
~~~~~~~~~~~~~~~~~~~~~~~~~~~~


Fri Jun 10 15:30:51 1994

For secondary structure prediction:
Jury on:       10    different architectures (version 5.94 ).

For solvent accessibility prediction:
Jury on:        5    different architectures (version 5.94 ).

Note: differently trained architectures, i.e., different versions can
result in different predictions.






About the protein:
------------------


HEADER     HYDROLASE(ACID PROTEINASE)
COMPND     HIV-1 PROTEASE (BRU ISOLATE)
SOURCE     GENE OF THE HUMAN IMMUNODEFICIENCY VIRUS /HIV-1$
AUTHOR     S.SPINELLI,P.M.ALZARI
SEQLENGTH    99
NCHAIN        1 chain(s) in 1hhp data set
NALIGN       58
(=number of aligned sequences in HSSP file)







Abbreviations:
--------------

secondary structure : H=helix, E=extended (sheet), blank=rest (loop)
accessibility       :
3st: relative solvent accessibility (acc) in 3 states:
b = 0-9%, i = 9-36%, e = 36-100%.
10st: relative solvent acc. in 10 states
= n corresponds to a relative acc. of n*n %



AA: amino acid sequence
OBS: values for experimentally observed 3D structures
OBS sec: DSSP classification of secondary structure
OBS acc: DSSP estimat of relative solvent accessibility area
O_3 acc: observed relative accessibility in 3 states: B, I, E
Note:  a blank is used for intermediate (i)

PHD: Profile network prediction HeiDelberg
PHD sec: prediction of secondary structure in three states
PHD acc: prediction of solvent accessibility in 10 states
P_3 acc: predicted relative accessibility in 3 states

Rel: Reliability index of prediction (0-9)
Rel sec: reliability of secondary structure prediction
Rel sec: reliability of accessibility prediction

detail:
prH sec: 'probability' for assigning helix
prE sec: 'probability' for assigning strand
prL:sec: 'probability' for assigning loop
Note:                 the 'probabilites' are scaled to the interval 0-9,
i.e. prH=5 means, that the signal at the first
output node is 0.5-0.6.

subset:
SUB: a subset of the prediction, for all residues with
a reliablity > n, with the following choices:
SUB sec: for secondary structure prediction n >= 5, which
corresponds to an expected accuracy > 82% (see
tables in header)
note: for this subset the following symbols are used:
L: is loop (for which above " " is used)
".": means that no prediction is made for this residue,
as the reliability is Rel < 5
SUB acc: for accessibility prediction n >= 4, which
corresponds to an expected correlation coefficient
> 0.69% (see tables in header)
Note:                 for this subset the following symbols are used:
"I": is intermediate (for which above " " is used)
".": means that no prediction is made for this residue,
as the reliability is Rel < 4





protein:       1hhp           length       99

                  ....,....1....,....2....,....3....,....4....,....5....,....6
         AA      |PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD|
         OBS sec |         EEEEE    EEEEEE       EEE        EEEEEEE  EEEEEEEEE|
         PHD sec |  EEEE   EEEEEE   EEEEEEE     EEEEEE        EEEEE   EEEEEE  |
         Rel sec |945644266799995261277564258753113431168997643688736515566412|
 detail:
         prH sec |000000000000000000000000000112332110000000000000000000000000
         prE sec |037766422899997424587676521012345654421001236788831246677644
         prL sec |962233577100002575411212378865322234578898763211157742222355
 subset: SUB sec |L.EE...LLEEEEEE.L..EEEE..LLLL........LLLLLL..EEEE.LL.EEEE...|

 ACC:
 3st:    O_3 acc |eeeeeeee e ebebee e eb   ee eeb beebe eeee e e eeee e eb  b |
         P_3 acc |ee e ee  ebebebeeeeeebbbeebbeeebbee e eeeeeeebbbbbbbbbe ee e|
 10st:   OBS acc |996789984637061785837043578476030672839887585647799585824415
         PHD acc |985736755606060686667000760076600765737976686000000000656757
         Rel acc |963702641314342164236264420143342621707671443251451210524626
 subset: SUB acc |ee.e..ei...e.e..ee..e.bbe...e..b.e..e.eee.ee..b.bb....e.ee.e|

                  ....,....7....,....8....,....9....,....10...,....11...,....1
         AA      |QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF|
         OBS sec |EEEEEE  EEEEEEEEEE     EE HHHHHHH      |
         PHD sec |EEEEEEE  EEEEEEEE     EEE  HHHHHH    E |
         Rel sec |599998284379999983998112251789961253009
 detail:
         prH sec |000000000000000000000000114888974322100
         prE sec |799998512688999983000445520000000011440
         prL sec |200001486310000016998444364110024565449
 subset: SUB sec |EEEEEE.L..EEEEEEE.LLL....L.HHHHH..L...L|

 ACC:
 3st:    O_3 acc |e eb beeeebe  bbbbe eeb bbe bbee eeeeee|
         P_3 acc |ebebe eeee ebbbbbbe bbebbb ebbeeb ee ee|
 10st:   OBS acc |836051686817350101849623006502774768899
         PHD acc |706065677756000000750060005600670567569
         Rel acc |714352357713224210521235373315462126236
 subset: SUB acc |e.e.e..eee....b...e....b.b...bee...e..e|





Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information