|
|
Example for requesting a prediction of transmembrane helicesBold face: keyword "predict transmembrane" Effect: a prediction of transmembrane helices is returned Joe Sequencer, Department of Advanced Protein Research, National Univeristy, Timbuktu joe@amino.churn.edu predict transmembrane # INFLUENZA A VIRUS (swiss: vmt2_iaann) MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDHLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE |
Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information