|
|
Example for requesting an output without ProDom domainsBold face: keyword "return no prodom" Effect: ProDom domains are not returned (and not retrieved) Joe Sequencer, Department of Advanced Protein Research, National Univeristy, Timbuktu joe@amino.churn.edu return no prodom # incredulase from paracoccus dementiae, translated from cDNA KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKD WWKVEVNDRQGFVPAAYVKKLD |
Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information