|
|
Example for requesting to return multiple alignment in MSF formatBold face: keyword "return msf" Effect: multiple alignments are returned in MSF format Joe Sequencer, Department of Advanced Protein Research, National Univeristy, Timbuktu joe@amino.churn.edu predict transmembrane return msf # incredulase from paracoccus dementiae, translated from cDNA KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKD WWKVEVNDRQGFVPAAYVKKLD |
Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information