pp-logo


sign in   

PredictProtein - [Output Example]

PHD predictions for fragment of prio_human

Different levels of data:
  1. PHD brief
  2. PHD normal
  3. PHD detail



  • PHDsec summary overall your protein can be classified as:
    mixed given the following classes:
    • 'all-alpha': %H > 45% AND %E < 5%
    • 'all-beta': %H < 5% AND %E > 45%
    • 'alpha-beta': %H > 30% AND %E > 20%
    • 'mixed': all others


  • Predicted secondary structure composition for your protein:
    %H: 0.0%E: 11.7%L: 88.3


  • Residue composition for your protein:
    %A: 5.0%C: 1.7%D: 2.8%E: 1.7%F: 1.7
    %G: 23.3%H: 5.0%I: 1.1%K: 3.9%L: 3.9
    %M: 4.4%N: 5.6%P: 8.3%Q: 5.6%R: 4.4
    %S: 5.0%T: 2.2%V: 3.9%W: 5.0%Y: 5.6



AA : amino acid sequence
PHD_sec: PHD predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop)
PHD = PHD: Profile network prediction HeiDelberg
Rel_sec: reliability index for PHDsec prediction (0=low to 9=high)
Note: for the brief presentation strong predictions marked by '*'
SUB_sec: subset of the PHDsec prediction, for all residues with an expected average accuracy > 82% (tables in header)
NOTE: for this subset the following symbols are used:
L: is loop (for which above ' ' is used)
.: means that no prediction is made for this residue, as the reliability is: Rel < 5
pH_sec: 'probability' for assigning helix (1=high, 0=low)
pE_sec: 'probability' for assigning strand (1=high, 0=low)
pL_sec: 'probability' for assigning neither helix, nor strand (1=high, 0=low)
P_3_acc: PHD predicted relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%.
Rel_acc: reliability index for PHDacc prediction (0=low to 9=high)
Note: for the brief presentation strong predictions marked by '*'
SUB_acc: subset of the PHDacc prediction, for all residues with an expected average correlation > 0.69 (tables in header)
NOTE: for this subset the following symbols are used:
I: is intermediate (for which above ' ' is used)
.: means that no prediction is made for this residue, as the reliability is: Rel < 4
PHD_acc: PHD predicted relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%).




PHD results (brief)

....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10...,....11...,....12...,....13...,....14...,....15...,....16...,....17...,....18 AA MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV PHD_sec EEEEEEEEEEEEE EEEEE EE E Rel_sec ** ******** **************************************** ****** ****** *** **** ****************** * **** *** ****** ****** ** **** ****** * * P_3_acc bbebbbbbbbbbbbbbeeebeeeeeeeeebeeebbee ebeb ebbeeeeeeebbbeb bebbbeb eebbbeb bebbbeb eeb bebebbbeeeeeeeeeeeeeeeeebebbbebbbebbbebbeeebeeeeeee eebeeeeeeeeeeebeebeeeeeb ebeeeeeee bbbbbb Rel_acc * * ***** ** **


PHD results (normal)

....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10...,....11...,....12...,....13...,....14...,....15...,....16...,....17...,....18 AA MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV PHD_sec EEEEEEEEEEEEE EEEEE EE E Rel_sec 971014899999974215788888888887677886558887667777677676655455566533336786553246753223578631334341368988886556576766522454655544433565479887544688987311356333688533430444798986351149 SUB_sec LL....EEEEEEEE...LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL.LLLLLL....LLLLLL...LLL....LLLL.........LLLLLLLLLLLLLLLLLL...L.LLLL.....LLL.LLLLLL..LLLLLL....LL...LLLL........LLLLLL.E...L P_3_acc bbebbbbbbbbbbbbbeeebeeeeeeeeebeeebbee ebeb ebbeeeeeeebbbeb bebbbeb eebbbeb bebbbeb eeb bebebbbeeeeeeeeeeeeeeeeebebbbebbbebbbebbeeebeeeeeee eebeeeeeeeeeeebeebeeeeeb ebeeeeeee bbbbbb Rel_acc 211534367454321100010001001100100000101111000001000001010200120102000101030001001100010002010100001011110000001002010110111101100010000110000111001100110001000000110001010100461164 SUB_acc ...b.b.bbbbb..................................................................................................................................................................bb..bb


PHD results (detail)

....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10...,....11...,....12...,....13...,....14...,....15...,....16...,....17...,....18 AA MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV pH_sec 1.0 pH_sec pH_sec 0.9 pH_sec pH_sec 0.8 pH_sec pH_sec 0.7 pH_sec pH_sec 0.6 pH_sec pH_sec . . . . 0.5 pH_sec pH_sec . .... ... .... ......... ... ... 0.4 pH_sec pH_sec . .. . ............... ...... ...... .......... ..... ...... ........ .. . 0.3 pH_sec pH_sec .... . .. .... .... ......................................................... . ............................... ... . . ... 0.2 pH_sec ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ pE_sec ..... 1.0 pE_sec pE_sec ........ 0.9 pE_sec pE_sec ........ . 0.8 pE_sec pE_sec .......... ... .. 0.7 pE_sec pE_sec ........... .... .. . 0.6 pE_sec pE_sec .............. . ..... .... 0.5 pE_sec pE_sec ............... .... .. ....... .... 0.4 pE_sec pE_sec ................ .. ..... .... ......... ..... 0.3 pE_sec pE_sec .................. . .. .. ..... ....................... ...... 0.2 pE_sec ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ pL_sec . . 1.0 pL_sec pL_sec . ........... .. ... . . .. .. ...... .... ..... .. ..... . 0.9 pL_sec pL_sec .. ...................................... ... ..... ... .... ................. . . . ..... ...... . .... ...... . 0.8 pL_sec pL_sec .. ............................................... ......... ..... ..... .... .................. .......... .................. .. ..... ......... .. 0.7 pL_sec pL_sec .. .................................................................................................................................... .......... ......... .. 0.6 pL_sec pL_sec .... ................................................................................................................................................ .......... .... 0.5 pL_sec pL_sec ..... ................................................................................................................................................................. .... 0.4 pL_sec pL_sec ...... ...................................................................................................................................................................... 0.3 pL_sec pL_sec ....... ....................................................................................................................................................................... 0.2 pL_sec ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ P_3_acc bbebbbbbbbbbbbbbeeebeeeeeeeeebeeebbee ebeb ebbeeeeeeebbbeb bebbbeb eebbbeb bebbbeb eeb bebebbbeeeeeeeeeeeeeeeeebebbbebbbebbbebbeeebeeeeeee eebeeeeeeeeeeebeebeeeeeb ebeeeeeee bbbbbb PHD_acc 100% PHD_acc PHD_acc 81% PHD_acc PHD_acc . . ... .... . . . ... .. ....... ... . . . .... . . .. .. .. .. ... ... 64% PHD_acc PHD_acc . ... ......... ... .. . . . ....... . . . .. . . . .. . . ................. . . . . ... ....... .. ........... .. ..... . ....... 49% PHD_acc PHD_acc . ... ......... ... .... . .. ....... . . . . ... . . . . ... . . . ................. . . . . ... .......... ........... .. ..... . ....... 36% PHD_acc PHD_acc . ... ......... ... .... . .. ....... . . . . ... . . . . ... . . . ................. . . . . ... .......... ........... .. ..... .. ........ 25% PHD_acc PHD_acc . ... ......... ... .... . .. ....... . . . . ... . . . . ... . . . ................. . . . . ... .......... ........... .. ..... .. ........ 16% PHD_acc PHD_acc . ... ......... ... .... . .. ....... . . . . ... . . . . ... . . . ................. . . . . ... .......... ........... .. ..... .. ........ 9% PHD_acc PHD_acc . ... ......... ... .... . .. ....... . . . . ... . . . . ... . . . ................. . . . . ... .......... ........... .. ..... .. ........ 4% PHD_acc ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------



Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information