pp-logo


sign in   

PredictProtein - [Output Example]
Example for requesting to return multiple alignment in HSSP format

Example for requesting to return multiple alignment in HSSP format

Bold face: keyword "return hssp format"

Effect: multiple alignments are returned in HSSP format without residue substitution profiles


Joe Sequencer, Department of Advanced Protein Research,
National Univeristy, Timbuktu 
joe@amino.churn.edu
return hssp format
# incredulase from paracoccus dementiae, translated from cDNA
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKD
WWKVEVNDRQGFVPAAYVKKLD

Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information