|
|
Example for requesting to return additionally the BLASTP outputBold face: keyword "return blast" Effect: alignments produced by BLASTP are returned in in addition Joe Sequencer, Department of Advanced Protein Research, National Univeristy, Timbuktu joe@amino.churn.edu return blast # incredulase from paracoccus dementiae, translated from cDNA KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKD WWKVEVNDRQGFVPAAYVKKLD |
Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information