|
|
Example for requesting an output without multiple alignmentBold face: keyword "return no alignment" Effect: predictions are returned (in the example given of transmembrane helices) Joe Sequencer, Department of Advanced Protein Research, National Univeristy, Timbuktu joe@amino.churn.edu predict transmembrane return no alignment # incredulase from paracoccus dementiae, translated from cDNA KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKD WWKVEVNDRQGFVPAAYVKKLD |
Copyright © 2008 Burkhard Rost, CUBIC all rights reserved. Terms of Use | Privacy Policy | Contact Information